(data stored in ACNUC7421 zone)

EMBL: CP000271.PE81

CP000271.PE81        Location/Qualifiers
FT   CDS             90021..90179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2946"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33049"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S90"
FT                   /protein_id="ABE33049.1"
FT                   /translation="MSFIFALFQKVSDLFASPHLPLDADYSYKARSREAERVRRSQATL
FT                   FGIKLSD"
     MSFIFALFQK VSDLFASPHL PLDADYSYKA RSREAERVRR SQATLFGIKL SD                52
//

If you have problems or comments...

PBIL Back to PBIL home page