(data stored in ACNUC7421 zone)

EMBL: CP000271.PE82

CP000271.PE82        Location/Qualifiers
FT   CDS             90619..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2945"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2945"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33050"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S89"
FT                   /protein_id="ABE33050.1"
FT                   /translation="MKTFNKTSRSLIATLLAGGALLAAGSAFAQERVVVENGPGPAVYG
FT                   QPHMMPVGVSINIGWHGDRYYDGHRYWAHDDWMRHHPHDYDPHHHGDRRPPPHY"
     MKTFNKTSRS LIATLLAGGA LLAAGSAFAQ ERVVVENGPG PAVYGQPHMM PVGVSINIGW        60
     HGDRYYDGHR YWAHDDWMRH HPHDYDPHHH GDRRPPPHY                               99
//

If you have problems or comments...

PBIL Back to PBIL home page