(data stored in ACNUC7421 zone)

EMBL: CP000271.PE84

CP000271.PE84        Location/Qualifiers
FT   CDS             92146..92796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2943"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33052"
FT                   /db_xref="GOA:Q13S87"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S87"
FT                   /protein_id="ABE33052.1"
FT                   /translation="MPFQPNPQSQLISMSHYFYDPATGHGLAHDPFKAIVAPRLIGWIS
FT                   SRDTEGTLNLAPYSFFGAFATFPPIIGFCSEGRKDSVTNIEATGEFVWNLANKPLAEQM
FT                   NRSSAPVPPSVDEFELAGLTPAPGRNVAVPHVAESPAALECKLLQVVRLHTLDGTPMDN
FT                   YLSLGQVVGVHINEAYLKDGLFDTHAAQPIMRAGYRADYAEIGDMFQMFRPGA"
     MPFQPNPQSQ LISMSHYFYD PATGHGLAHD PFKAIVAPRL IGWISSRDTE GTLNLAPYSF        60
     FGAFATFPPI IGFCSEGRKD SVTNIEATGE FVWNLANKPL AEQMNRSSAP VPPSVDEFEL       120
     AGLTPAPGRN VAVPHVAESP AALECKLLQV VRLHTLDGTP MDNYLSLGQV VGVHINEAYL       180
     KDGLFDTHAA QPIMRAGYRA DYAEIGDMFQ MFRPGA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page