(data stored in ACNUC7421 zone)

EMBL: CP000271.PE85

CP000271.PE85        Location/Qualifiers
FT   CDS             92978..93412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2942"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2942"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33053"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S86"
FT                   /protein_id="ABE33053.1"
FT                   /translation="MSTEFATQFSHVRPQDTSYEDQGLRDFFLYRDLGIAQATGGKVLA
FT                   QLVKANHAPEQGTGWHRHEADFHIVIMLKGWARFMYGDKETLVAAGDCVHQAPGIVHYL
FT                   FDYSDDMEYIEIVSPADFKSIEVEGPCDVPAVTPWKGVAA"
     MSTEFATQFS HVRPQDTSYE DQGLRDFFLY RDLGIAQATG GKVLAQLVKA NHAPEQGTGW        60
     HRHEADFHIV IMLKGWARFM YGDKETLVAA GDCVHQAPGI VHYLFDYSDD MEYIEIVSPA       120
     DFKSIEVEGP CDVPAVTPWK GVAA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page