(data stored in ACNUC7421 zone)

EMBL: CP000271.PE92

CP000271.PE92        Location/Qualifiers
FT   CDS             103117..106968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2935"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33060"
FT                   /db_xref="GOA:Q13S79"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S79"
FT                   /protein_id="ABE33060.1"
FT                   /translation="MCKPRLTFISRERFTTYTAACGIFVFAAGLPPHYPIPSMASLNKA
FT                   SLASSMQTVRDVAQSRRTRRVITGLLIFLVVFGLLGFFAAPPLIRHVAEQQLSKQLDRP
FT                   ATIGRIALNPYTLRLEADRVHIGERGGAGDFVDISRLIVQPSWSSLFRAAPIIDQVQLD
FT                   SPRFHIVRYDAQRFNFTDLIEKFSKQPARPDSKPTLFSVSNIRLENGQITFDDKLLGAT
FT                   HVIDQWKLGIPFIATLPSKTDIFVEPLLRARIDGSPLAIDGKTKPFAASRESEVSLRFD
FT                   GLDVPRLMSYAPTRLPVIVQSGKLSTDLKLNFVVSNDAPSLRVAGTIDLNDVDVQDQGK
FT                   APFFAARAVHVAAATLDPFRNLYHFDEIRIDAPTASLARDKDGVLSVEKMFAPEPAAAQ
FT                   PAASAPVAASAANAAAKAAPPLDLAIKRFVLNDGTVNVRDNAASRPVDAGLQKLAVTLT
FT                   DFSTLATAPAHYTLNTDLKDSGGSLGVAGAFGFAAKTASAKLDLKSLNLPQLQPYLDTA
FT                   TAAQLRDGKLSATANVGANWSKLPAAVMVTDTQLDLQSLKVAAPGAKDPVIALTQGSAR
FT                   VRQVDVAARTAEIASIDTTGLAVDAERLKDGSINLAALGGRHEATPQRTAIHAVKKAQA
FT                   EGPAWHYKIGELVLKDATANFTDNTTPQPVKLNITPLQLKVQNISDDLSRPLPVDLQAT
FT                   LNRKGTLGVKGDVTATPLKVAVKVNANRLDAAAFEPYFGGKLNAVIASALLNANGDLAL
FT                   SQAKSLKATYRGDMALVDVRMLDKASSDPFAGWGSLALSSLKADYDEHGTVVDAGRVTF
FT                   TKFYGRVLLDAQGKLNLRDVVAHETGAAQSLTRDKSGADPVPLTPQAASTVAAASAPVP
FT                   ASAAAATVTAATAPQSPVKLHFGQLVLQQGRVTYTDNFIKPNFTANLVGIQGTVGAFGT
FT                   QSTTAAPVDIAAKLAANGPLSIRGTINPLIAKPALDLTAVAHDIELTNLTPYSAKYAGY
FT                   PITKGKLNVDLHYTLENDQLNANNHIFIDQLTFGDHVENDTATRLPVRLAISLLKNSRG
FT                   EIDVNLPVSGSLSNPEFSIGGLIWHAVLNLLQKAVTAPFSLIANAFGGNGEELGYVEFE
FT                   PGSATLTDADTKKLDTIVKALADKSSIRMDLIGRVDPAIDEPALRTGYVERLVKQQKIK
FT                   DVVGNGESVDLSTVTVDPKEYDKYLSKAYKSADFKKPRNFVGLTKSLPDDEMKSALAAN
FT                   APIDDASLRQLAQQRAQSVQQYLEGKIDSSRVFIVAPKLNADGIKDKGATTRVDFGLK"
     MCKPRLTFIS RERFTTYTAA CGIFVFAAGL PPHYPIPSMA SLNKASLASS MQTVRDVAQS        60
     RRTRRVITGL LIFLVVFGLL GFFAAPPLIR HVAEQQLSKQ LDRPATIGRI ALNPYTLRLE       120
     ADRVHIGERG GAGDFVDISR LIVQPSWSSL FRAAPIIDQV QLDSPRFHIV RYDAQRFNFT       180
     DLIEKFSKQP ARPDSKPTLF SVSNIRLENG QITFDDKLLG ATHVIDQWKL GIPFIATLPS       240
     KTDIFVEPLL RARIDGSPLA IDGKTKPFAA SRESEVSLRF DGLDVPRLMS YAPTRLPVIV       300
     QSGKLSTDLK LNFVVSNDAP SLRVAGTIDL NDVDVQDQGK APFFAARAVH VAAATLDPFR       360
     NLYHFDEIRI DAPTASLARD KDGVLSVEKM FAPEPAAAQP AASAPVAASA ANAAAKAAPP       420
     LDLAIKRFVL NDGTVNVRDN AASRPVDAGL QKLAVTLTDF STLATAPAHY TLNTDLKDSG       480
     GSLGVAGAFG FAAKTASAKL DLKSLNLPQL QPYLDTATAA QLRDGKLSAT ANVGANWSKL       540
     PAAVMVTDTQ LDLQSLKVAA PGAKDPVIAL TQGSARVRQV DVAARTAEIA SIDTTGLAVD       600
     AERLKDGSIN LAALGGRHEA TPQRTAIHAV KKAQAEGPAW HYKIGELVLK DATANFTDNT       660
     TPQPVKLNIT PLQLKVQNIS DDLSRPLPVD LQATLNRKGT LGVKGDVTAT PLKVAVKVNA       720
     NRLDAAAFEP YFGGKLNAVI ASALLNANGD LALSQAKSLK ATYRGDMALV DVRMLDKASS       780
     DPFAGWGSLA LSSLKADYDE HGTVVDAGRV TFTKFYGRVL LDAQGKLNLR DVVAHETGAA       840
     QSLTRDKSGA DPVPLTPQAA STVAAASAPV PASAAAATVT AATAPQSPVK LHFGQLVLQQ       900
     GRVTYTDNFI KPNFTANLVG IQGTVGAFGT QSTTAAPVDI AAKLAANGPL SIRGTINPLI       960
     AKPALDLTAV AHDIELTNLT PYSAKYAGYP ITKGKLNVDL HYTLENDQLN ANNHIFIDQL      1020
     TFGDHVENDT ATRLPVRLAI SLLKNSRGEI DVNLPVSGSL SNPEFSIGGL IWHAVLNLLQ      1080
     KAVTAPFSLI ANAFGGNGEE LGYVEFEPGS ATLTDADTKK LDTIVKALAD KSSIRMDLIG      1140
     RVDPAIDEPA LRTGYVERLV KQQKIKDVVG NGESVDLSTV TVDPKEYDKY LSKAYKSADF      1200
     KKPRNFVGLT KSLPDDEMKS ALAANAPIDD ASLRQLAQQR AQSVQQYLEG KIDSSRVFIV      1260
     APKLNADGIK DKGATTRVDF GLK                                              1283
//

If you have problems or comments...

PBIL Back to PBIL home page