(data stored in SCRATCH zone)

EMBL: CP000271.PE94

CP000271.PE94        Location/Qualifiers
FT   CDS             108660..109757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2933"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33062"
FT                   /db_xref="GOA:Q13S77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S77"
FT                   /protein_id="ABE33062.1"
FT                   /translation="MKTDDVIVSFRGVRKTYDGETLVVKQLDLDIYQGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIWLDGTLLNTVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKISAQERAHRTNNALKMVRMESFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKSLHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIANVDGEYCEFRLSDGTRLTGRNIGGARAGTPA
FT                   VACIRPERMKLANGLSRPGANALAGEARGLIYFGDHVRMRCGLPQQDECFVKVPLGTDA
FT                   LDTFAPGAPVALEFAPEHLRVFAGA"
     MKTDDVIVSF RGVRKTYDGE TLVVKQLDLD IYQGEFLTLL GPSGSGKTTC LMMLAGFEFP        60
     TGGEIWLDGT LLNTVPPHKR NIGMVFQNYA LFPHLTVEQN VAYPLTVRKI SAQERAHRTN       120
     NALKMVRMES FAKRYPAQLS GGQQQRIALA RALVFEPKLV LMDEPLGALD KQLREHMQYE       180
     LKSLHEKLGV TFVYVTHDQG EALTMSDRVA VFDKGIVQQL DTVDRLYESP CNEFVANFIG       240
     DSNRLRGTIA NVDGEYCEFR LSDGTRLTGR NIGGARAGTP AVACIRPERM KLANGLSRPG       300
     ANALAGEARG LIYFGDHVRM RCGLPQQDEC FVKVPLGTDA LDTFAPGAPV ALEFAPEHLR       360
     VFAGA                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page