(data stored in SCRATCH zone)

EMBL: CP000271.PE95

CP000271.PE95        Location/Qualifiers
FT   CDS             109867..110916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2932"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33063"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S76"
FT                   /protein_id="ABE33063.1"
FT                   /translation="MSKIGKSRCAIAVGAVALALGAAQVNAAELTVVNFGGANGDAQKV
FT                   AFNQPFEKETSNKVTAVEYNGEQAKVKAMVEARHVNWDVVEVESGDIGRGCDEGLYEKL
FT                   DWSKIGKKSDLIPEAPQTCGVGFFVWSTALAYNADKLKTAPAGWADFWDVKKFPGKRAM
FT                   RKGARYNLEFALMADGVPPKDVYKVLATKAGQDRAFKKLDELKPNIQWWEAGAQPPQFL
FT                   VAGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGTPNKALAEKYIAYSI
FT                   SSKPQQDYAHNIAYGPVNVTAIKALDPKTLANLPNSPANGKNAVLQDLAFWTDHGDELE
FT                   QRFSSWASK"
     MSKIGKSRCA IAVGAVALAL GAAQVNAAEL TVVNFGGANG DAQKVAFNQP FEKETSNKVT        60
     AVEYNGEQAK VKAMVEARHV NWDVVEVESG DIGRGCDEGL YEKLDWSKIG KKSDLIPEAP       120
     QTCGVGFFVW STALAYNADK LKTAPAGWAD FWDVKKFPGK RAMRKGARYN LEFALMADGV       180
     PPKDVYKVLA TKAGQDRAFK KLDELKPNIQ WWEAGAQPPQ FLVAGDVVMS TAYNGRIDAA       240
     QKEGKNLKVV WNGSIYDLDY WAIPKGTPNK ALAEKYIAYS ISSKPQQDYA HNIAYGPVNV       300
     TAIKALDPKT LANLPNSPAN GKNAVLQDLA FWTDHGDELE QRFSSWASK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page