(data stored in SCRATCH zone)

EMBL: CP000271.PE96

CP000271.PE96        Location/Qualifiers
FT   CDS             110992..112260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2931"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2931"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33064"
FT                   /db_xref="GOA:Q13S75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S75"
FT                   /protein_id="ABE33064.1"
FT                   /translation="MTIAADSTPESSGRLKRELRAAESRKRAVALLLIAPLAIFLLLIF
FT                   VVPIGALLTRAAQNPEVVNALPHTLTALSAWDRKTPPPDAAYVALATDLAAVADSDGMG
FT                   ALARRLNVEIPGYRSLIAKSARAMPFVDDNSKPLQLTPAQVHAKFVELDERWNDIAYWQ
FT                   TIAKNSSAYSPFYLLASLDHKQDAFGHVIPTDPEQQIYLAVFSRTFVIGAAVTFFALLL
FT                   GYPLAYWISTLPERRANLVMILVLIPFWTSILVRVAAWIVILQSEGLVNKALIGSGLLH
FT                   DPLSLLFNRTGVYISMTHILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYV
FT                   PQTYPGIGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYYTNVTINWGMACALGGL
FT                   LLAATLVLYVIYGRFTRSSLSLG"
     MTIAADSTPE SSGRLKRELR AAESRKRAVA LLLIAPLAIF LLLIFVVPIG ALLTRAAQNP        60
     EVVNALPHTL TALSAWDRKT PPPDAAYVAL ATDLAAVADS DGMGALARRL NVEIPGYRSL       120
     IAKSARAMPF VDDNSKPLQL TPAQVHAKFV ELDERWNDIA YWQTIAKNSS AYSPFYLLAS       180
     LDHKQDAFGH VIPTDPEQQI YLAVFSRTFV IGAAVTFFAL LLGYPLAYWI STLPERRANL       240
     VMILVLIPFW TSILVRVAAW IVILQSEGLV NKALIGSGLL HDPLSLLFNR TGVYISMTHI       300
     LLPFMILPLY SVMKSIPPTY QRAAVSLGSH PFAAFWRVYV PQTYPGIGAG ALLVFILAIG       360
     YYITPALLGG PNDQMVSYYV AYYTNVTINW GMACALGGLL LAATLVLYVI YGRFTRSSLS       420
     LG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page