(data stored in SCRATCH zone)

EMBL: CP000271.PE97

CP000271.PE97        Location/Qualifiers
FT   CDS             112275..113114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2930"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2930"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33065"
FT                   /db_xref="GOA:Q13S74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S74"
FT                   /protein_id="ABE33065.1"
FT                   /translation="MKLAKPLFAPHTSWVERVWYFALRGLAVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGWSLRWYQNLIASDEWRMAARNSFIVAPSATVVATVLGTLAAIGLTK
FT                   ANFRGKGLLMAILISPMIVPVVVVGVGMYLFFAPLGLANTYIGLILAHASLGVPFVVTT
FT                   VAATLQGFNYNLVRASLSLGANPVKTFFRITLPVIAPGVISGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIIFSTSLLLALEWLRGRNAARAVRA"
     MKLAKPLFAP HTSWVERVWY FALRGLAVLT LLYLILPVLA IVPLSFSSST FLVYPIPGWS        60
     LRWYQNLIAS DEWRMAARNS FIVAPSATVV ATVLGTLAAI GLTKANFRGK GLLMAILISP       120
     MIVPVVVVGV GMYLFFAPLG LANTYIGLIL AHASLGVPFV VTTVAATLQG FNYNLVRASL       180
     SLGANPVKTF FRITLPVIAP GVISGALFAF ATSFDEVVVT LFLAGADQTT LPRQMFTGIR       240
     ENISPTIAAL ATILIIFSTS LLLALEWLRG RNAARAVRA                              279
//

If you have problems or comments...

PBIL Back to PBIL home page