(data stored in ACNUC7421 zone)

EMBL: CP000271.PE98

CP000271.PE98        Location/Qualifiers
FT   CDS             113271..114350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2929"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33066"
FT                   /db_xref="GOA:Q13S73"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S73"
FT                   /protein_id="ABE33066.1"
FT                   /translation="MKHQLTVLVCALALTACADHAARERLGIEDATLLKTGFGATQDEA
FT                   AGAVNAQWVSTYAPIASSNTALAGLQTRLDRLPGDKNSYFYAKAQCWINAAQQARQAND
FT                   RWGFVEEAIGQAATITIGLENGAPLSAANPALRTVSTVRPDLWKIVNTIKADPAVAQCP
FT                   QAQQPLACAEVELAQAGHDAWRRSFTNAEKRLPEVQDNLRQSAQRALQCKQALQAPASM
FT                   SAPEQGSVAKPQQKITLKADSLFRFNGGDEAAMLPAGKRQLDDVATGLNNAPALHELKI
FT                   TGYADRLGDKSYNLGLSMQRARTVERYLRAHGVSVPITAQGRGSANPLVDCRRTKRDAL
FT                   VKCLAPNRRVEIELVAARS"
     MKHQLTVLVC ALALTACADH AARERLGIED ATLLKTGFGA TQDEAAGAVN AQWVSTYAPI        60
     ASSNTALAGL QTRLDRLPGD KNSYFYAKAQ CWINAAQQAR QANDRWGFVE EAIGQAATIT       120
     IGLENGAPLS AANPALRTVS TVRPDLWKIV NTIKADPAVA QCPQAQQPLA CAEVELAQAG       180
     HDAWRRSFTN AEKRLPEVQD NLRQSAQRAL QCKQALQAPA SMSAPEQGSV AKPQQKITLK       240
     ADSLFRFNGG DEAAMLPAGK RQLDDVATGL NNAPALHELK ITGYADRLGD KSYNLGLSMQ       300
     RARTVERYLR AHGVSVPITA QGRGSANPLV DCRRTKRDAL VKCLAPNRRV EIELVAARS        359
//

If you have problems or comments...

PBIL Back to PBIL home page