(data stored in ACNUC7421 zone)

EMBL: CP000272.NAPA

CP000272.NAPA        Location/Qualifiers
FT   CDS             392156..394639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="Bxe_C0367"
FT                   /product="periplasmic nitrate reductase subunit NapA
FT                   apoprotein"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36274"
FT                   /db_xref="GOA:Q13I15"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13I15"
FT                   /protein_id="ABE36274.1"
FT                   /translation="MTLSRRAFIKQTAAATAASAAGVVLPGVDALAASDSLTWSKAPCR
FT                   FCGTGCGVSVGVKNGKVVATQGDPQAEVNRGLNCVKGYFLSKIMYGQDRLTTPLLRMKD
FT                   GKYAKDGEFAPVSWDQAFDVMADHFKRTLKEKGPTAVGMFGSGQWTVWEGYAAVKLMKA
FT                   GFRSNNLDPNARHCMASAVTGFMRTFGMDEPMGCYDDIEQADTFVLWGSNMSEMHPILW
FT                   TRITDRRLSTPTTRVVVLSTFEHRSFDLADQTIIFTPQSDLAILNYIANYIIRNGNVNR
FT                   DFVNRHTVFKQGNADIGYGLRPDNPLQKTARNAGDPNGSQPITFDEFAKFVSKYDAAYV
FT                   TKLSGVPQNKLDQLARLYADPKVKVMSFWTMGFNQHTRGTWANNMVYNLHLLTGKIATP
FT                   GNSPFSLTGQPSACGTAREVGTFSHRLPADMVVTNPKHREEAEHIWKLPAGTIPDKPGY
FT                   HAVLQNRMLRDGKLNAYWVQVNNNVQAAANINGEALPGYRNPQAFVVVSDVYPTVTAVA
FT                   ADLILPSAMWVEKEGAYGNAERRTQFWHQLVDAPAGARSDLWQLVEFSKRFKVEEVWPA
FT                   DLLAKKPEYRGKTLYDVLYRNGQVDRFALTETDSHYRNDEAKAFGFYIQKGLFEEYASF
FT                   GRGHGHDLAPFDAYHKARGLRWPVVNGKETRWRYKEGSDPYVKTGTGWQFYGNPDGRAV
FT                   IYALPYEPPPEVPDKEYPFWLATGRVLEHWHSGSMTRRVPELYRAFPNAVCFMHPDDAK
FT                   AMGVRRGVEVKVMSRRGYILTRVETRGRDKPPRGLVFVPWFDSSQLINKVTLDATDPIS
FT                   LQTDYKKCAVKIVKV"
     MTLSRRAFIK QTAAATAASA AGVVLPGVDA LAASDSLTWS KAPCRFCGTG CGVSVGVKNG        60
     KVVATQGDPQ AEVNRGLNCV KGYFLSKIMY GQDRLTTPLL RMKDGKYAKD GEFAPVSWDQ       120
     AFDVMADHFK RTLKEKGPTA VGMFGSGQWT VWEGYAAVKL MKAGFRSNNL DPNARHCMAS       180
     AVTGFMRTFG MDEPMGCYDD IEQADTFVLW GSNMSEMHPI LWTRITDRRL STPTTRVVVL       240
     STFEHRSFDL ADQTIIFTPQ SDLAILNYIA NYIIRNGNVN RDFVNRHTVF KQGNADIGYG       300
     LRPDNPLQKT ARNAGDPNGS QPITFDEFAK FVSKYDAAYV TKLSGVPQNK LDQLARLYAD       360
     PKVKVMSFWT MGFNQHTRGT WANNMVYNLH LLTGKIATPG NSPFSLTGQP SACGTAREVG       420
     TFSHRLPADM VVTNPKHREE AEHIWKLPAG TIPDKPGYHA VLQNRMLRDG KLNAYWVQVN       480
     NNVQAAANIN GEALPGYRNP QAFVVVSDVY PTVTAVAADL ILPSAMWVEK EGAYGNAERR       540
     TQFWHQLVDA PAGARSDLWQ LVEFSKRFKV EEVWPADLLA KKPEYRGKTL YDVLYRNGQV       600
     DRFALTETDS HYRNDEAKAF GFYIQKGLFE EYASFGRGHG HDLAPFDAYH KARGLRWPVV       660
     NGKETRWRYK EGSDPYVKTG TGWQFYGNPD GRAVIYALPY EPPPEVPDKE YPFWLATGRV       720
     LEHWHSGSMT RRVPELYRAF PNAVCFMHPD DAKAMGVRRG VEVKVMSRRG YILTRVETRG       780
     RDKPPRGLVF VPWFDSSQLI NKVTLDATDP ISLQTDYKKC AVKIVKV                     827
//

If you have problems or comments...

PBIL Back to PBIL home page