(data stored in ACNUC7421 zone)

EMBL: CP000272.NAPC

CP000272.NAPC        Location/Qualifiers
FT   CDS             395139..395753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="Bxe_C0369"
FT                   /product="periplasmic nitrate reductase subunit NapC"
FT                   /note="Citation: Adv Microb Physiol 2001; 45:50-112"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36276"
FT                   /db_xref="GOA:Q13I13"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I13"
FT                   /protein_id="ABE36276.1"
FT                   /translation="MRDLIRRYWKTINRPTAYYSLGFLTLGGFIAGVVFWGAFNTAMEL
FT                   TNTEAFCTGCHEMRDNTYAELKTTIHYSNRSGFHAKCSDCHVPHEWTAKIARKMQASKE
FT                   VWAKVFGVVNTREKFEDKRLELAEHEWARFKANDSLECRNCHQFEYMDFTRQSPRAQEA
FT                   HQRFLATGERTCIDCHKGIAHQLPNMTQAQADADAKQAAGH"
     MRDLIRRYWK TINRPTAYYS LGFLTLGGFI AGVVFWGAFN TAMELTNTEA FCTGCHEMRD        60
     NTYAELKTTI HYSNRSGFHA KCSDCHVPHE WTAKIARKMQ ASKEVWAKVF GVVNTREKFE       120
     DKRLELAEHE WARFKANDSL ECRNCHQFEY MDFTRQSPRA QEAHQRFLAT GERTCIDCHK       180
     GIAHQLPNMT QAQADADAKQ AAGH                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page