(data stored in SCRATCH zone)

EMBL: CP000272.PE103

CP000272.PE103       Location/Qualifiers
FT   CDS             117852..118823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0105"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36031"
FT                   /db_xref="GOA:Q13IQ8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ8"
FT                   /protein_id="ABE36031.1"
FT                   /translation="MTRHSSPGRRHFIEAGLALALASAIPGAHAQGGASSARVLRIGYQ
FT                   KGPFSILKGRGTLDKRLAALGTRVEWTEFPSGPPQLEALNVGSIDFGDVGEAPPIFAQA
FT                   AGAPFVYYGQTAKRPVSEAVVVPDDSPVTSFSELKGKRIALVKGSNTHFLLVRLLAAAK
FT                   IDYRDVTPVWLSPSDARAAFERKAVDAWAIWDPFLAVAQKTANARIIADGSGVVANRAF
FT                   YFTSHNYVQKNDDVLRVVLGEIGALDKWVEANRSEAAGEFAQLWGVPREIVEVALARLQ
FT                   YGVEPISRETLADQQRIADAFYELKLLPKRIEVAHAAPPSLA"
     MTRHSSPGRR HFIEAGLALA LASAIPGAHA QGGASSARVL RIGYQKGPFS ILKGRGTLDK        60
     RLAALGTRVE WTEFPSGPPQ LEALNVGSID FGDVGEAPPI FAQAAGAPFV YYGQTAKRPV       120
     SEAVVVPDDS PVTSFSELKG KRIALVKGSN THFLLVRLLA AAKIDYRDVT PVWLSPSDAR       180
     AAFERKAVDA WAIWDPFLAV AQKTANARII ADGSGVVANR AFYFTSHNYV QKNDDVLRVV       240
     LGEIGALDKW VEANRSEAAG EFAQLWGVPR EIVEVALARL QYGVEPISRE TLADQQRIAD       300
     AFYELKLLPK RIEVAHAAPP SLA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page