(data stored in ACNUC7421 zone)

EMBL: CP000272.PE105

CP000272.PE105       Location/Qualifiers
FT   CDS             complement(120457..121398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0107"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36033"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ6"
FT                   /protein_id="ABE36033.1"
FT                   /translation="MKSQRITASIFLSAIASLAMSLSTLALAANTLDLNPEQRDRIRVE
FT                   KDPAAINAVGGSYRFVKDDTLTIGIHPFIPPISTYATDARTIVGFDADLAQVIADSLGK
FT                   KLELVPVAWADWPLALQSGKFDAVISNVTVTEERKAKFDFSTYRKDQLGFYVKSDSKIT
FT                   SLQEPKDIAGLRIITDPGTNQEKILLEWDKQNVAHGLKPITVQYYDDDAVKNLAIQSGR
FT                   ADAVFSVNAVQAYQAAEQRKTRLVGTVSGGWPRTAEVAITTRKGSGLADALTTALNDLI
FT                   KSGTYTHVLDKWNLGSEAISKASTNPPGLPKL"
     MKSQRITASI FLSAIASLAM SLSTLALAAN TLDLNPEQRD RIRVEKDPAA INAVGGSYRF        60
     VKDDTLTIGI HPFIPPISTY ATDARTIVGF DADLAQVIAD SLGKKLELVP VAWADWPLAL       120
     QSGKFDAVIS NVTVTEERKA KFDFSTYRKD QLGFYVKSDS KITSLQEPKD IAGLRIITDP       180
     GTNQEKILLE WDKQNVAHGL KPITVQYYDD DAVKNLAIQS GRADAVFSVN AVQAYQAAEQ       240
     RKTRLVGTVS GGWPRTAEVA ITTRKGSGLA DALTTALNDL IKSGTYTHVL DKWNLGSEAI       300
     SKASTNPPGL PKL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page