(data stored in ACNUC7421 zone)

EMBL: CP000272.PE107

CP000272.PE107       Location/Qualifiers
FT   CDS             complement(123359..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0110"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36035"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IQ4"
FT                   /protein_id="ABE36035.1"
FT                   /translation="MAEVVSDNHQRRIYRLGVPDDDALAGETARLIARQGGDNGIRALS
FT                   LNAATARRFTRYFEHLSSADGNNLPLAGRVIAAGVVPDDKYCGPAA"
     MAEVVSDNHQ RRIYRLGVPD DDALAGETAR LIARQGGDNG IRALSLNAAT ARRFTRYFEH        60
     LSSADGNNLP LAGRVIAAGV VPDDKYCGPA A                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page