(data stored in ACNUC7421 zone)

EMBL: CP000272.PE112

CP000272.PE112       Location/Qualifiers
FT   CDS             128987..130045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0115"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36040"
FT                   /db_xref="GOA:Q13IP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP9"
FT                   /protein_id="ABE36040.1"
FT                   /translation="MSTQFESIAPHAPASGTPAGDATRAAPRRGLSRGVLSAGLAAIAW
FT                   LASAAQTTWWPSLDDWPYTREFIVLKLALAAFAVALGVAGWRGSQSPSPTAARASAWLR
FT                   AMPWLLALALGVSAWEAVTAQLEWLPRPFFAPPQALIGVFAEDYPRLGSSVVHSFGLLA
FT                   YGYVLGAVAGFVTGVSIGWSQAVSYWVHPVLRLIGPLPATAWLPLAFFFFPSSFSASVF
FT                   LIALATAFPVAVLTWSGVASVNPAYYDIARTLGARPSFLILRVAIPAALPSVFVGLFMG
FT                   LGASFSVLIVAEMMGVKAGLGWYLQWAQGWAAYSNMYAALLVMALMCSGLITLLFRVRD
FT                   RLLAWQKGLLKW"
     MSTQFESIAP HAPASGTPAG DATRAAPRRG LSRGVLSAGL AAIAWLASAA QTTWWPSLDD        60
     WPYTREFIVL KLALAAFAVA LGVAGWRGSQ SPSPTAARAS AWLRAMPWLL ALALGVSAWE       120
     AVTAQLEWLP RPFFAPPQAL IGVFAEDYPR LGSSVVHSFG LLAYGYVLGA VAGFVTGVSI       180
     GWSQAVSYWV HPVLRLIGPL PATAWLPLAF FFFPSSFSAS VFLIALATAF PVAVLTWSGV       240
     ASVNPAYYDI ARTLGARPSF LILRVAIPAA LPSVFVGLFM GLGASFSVLI VAEMMGVKAG       300
     LGWYLQWAQG WAAYSNMYAA LLVMALMCSG LITLLFRVRD RLLAWQKGLL KW               352
//

If you have problems or comments...

PBIL Back to PBIL home page