(data stored in SCRATCH zone)

EMBL: CP000272.PE120

CP000272.PE120       Location/Qualifiers
FT   CDS             136115..137047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0123"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36048"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IP1"
FT                   /protein_id="ABE36048.1"
FT                   /translation="MTATVGGLTALGDTAARQLANATKTVPQLATITPRWLTHLLQWLP
FT                   VEAGIYRLNQVKNPEAVVAACTAREDESILPRTFVPYEEQPREYFLNAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINNPDYGLLANVAEEQRVFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLFQPGVAGEQGPGLSVRFMGINNHAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIGKYHDYPDTYK"
     MTATVGGLTA LGDTAARQLA NATKTVPQLA TITPRWLTHL LQWLPVEAGI YRLNQVKNPE        60
     AVVAACTARE DESILPRTFV PYEEQPREYF LNAVSTVLDV HTRISDLYSS PHDQIKEQLR       120
     LTIETIKELQ ESQLINNPDY GLLANVAEEQ RVFPLTGAPT PDDLDELLTK VWKEPAFFLT       180
     HPLAIAAFGR ECTRRGVPPP TVSLFGSQFL TWRGIPLIPS DKVPVADGKT KILLLRVGDK       240
     RQGVVGLFQP GVAGEQGPGL SVRFMGINNH AIASYLISLY CSLAVHSPDA LAVLDDVEIG       300
     KYHDYPDTYK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page