(data stored in SCRATCH zone)

EMBL: CP000272.PE124

CP000272.PE124       Location/Qualifiers
FT   CDS             141288..142106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0127"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36052"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN7"
FT                   /protein_id="ABE36052.1"
FT                   /translation="MKIWTRSAAVVGLLLTLSGVAHADRLDDIKKAGVLRVATFDSNPP
FT                   FGFVDPKTNQIVGLDVDYARAVAAKLGVKLEIQPTNPANRIAFLKSNKVDLVFANFTIT
FT                   DERKKEIDFSTPYFASGTQFIAKKGVLKSPQQLDSLRIGADKGTTNEQQVRAQFPAATI
FT                   VAYDDTPFAFAALRAGNVQAITQDGPKLVALLANVPDKEKYEIPPFTISNDYEGVGVPK
FT                   NEARLLNVVNETLVGLEANGNAAKIYDQWFGPGSKAPLPRLFKIGDPQKS"
     MKIWTRSAAV VGLLLTLSGV AHADRLDDIK KAGVLRVATF DSNPPFGFVD PKTNQIVGLD        60
     VDYARAVAAK LGVKLEIQPT NPANRIAFLK SNKVDLVFAN FTITDERKKE IDFSTPYFAS       120
     GTQFIAKKGV LKSPQQLDSL RIGADKGTTN EQQVRAQFPA ATIVAYDDTP FAFAALRAGN       180
     VQAITQDGPK LVALLANVPD KEKYEIPPFT ISNDYEGVGV PKNEARLLNV VNETLVGLEA       240
     NGNAAKIYDQ WFGPGSKAPL PRLFKIGDPQ KS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page