(data stored in ACNUC7421 zone)

EMBL: CP000272.PE125

CP000272.PE125       Location/Qualifiers
FT   CDS             142190..142948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0128"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36053"
FT                   /db_xref="GOA:Q13IN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN6"
FT                   /protein_id="ABE36053.1"
FT                   /translation="MMTMNAWLEPRYVAWIWRGFAMTLALSASVAVCATLLGFALALAR
FT                   SAPSAALRRAAAGYVLIFRNSPLLVQLLFWYFGAAVLLPDGLMNWLNTPHVVVLGPVTL
FT                   SWPTFEFVAGWLGLTCYSTTFIGEEFRAGMRGVRDGQYQAAAALGLTRFATFRHVILPQ
FT                   AVRIATPPLAGQYMNVIKNSSLTMAIGFAELSYSSRQVETETLKTFQSFGMATLLYIAA
FT                   IATIEVALLIWQRRGAYGSGGVRFPRGGRS"
     MMTMNAWLEP RYVAWIWRGF AMTLALSASV AVCATLLGFA LALARSAPSA ALRRAAAGYV        60
     LIFRNSPLLV QLLFWYFGAA VLLPDGLMNW LNTPHVVVLG PVTLSWPTFE FVAGWLGLTC       120
     YSTTFIGEEF RAGMRGVRDG QYQAAAALGL TRFATFRHVI LPQAVRIATP PLAGQYMNVI       180
     KNSSLTMAIG FAELSYSSRQ VETETLKTFQ SFGMATLLYI AAIATIEVAL LIWQRRGAYG       240
     SGGVRFPRGG RS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page