(data stored in ACNUC7421 zone)

EMBL: CP000272.PE126

CP000272.PE126       Location/Qualifiers
FT   CDS             142945..143640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0129"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36054"
FT                   /db_xref="GOA:Q13IN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN5"
FT                   /protein_id="ABE36054.1"
FT                   /translation="MSAVDWLPILRYLLAGAFPNGPLGGIALTVMLTLTSAALSALLGL
FT                   AGGVSLVMTRGLPHLLLLAVVGLFRAIPVLMLIFWTFFLMPVLLHVDVPGLATVVCALA
FT                   LIGGAYLSHSVQAGIVAVGDGQWQAAQSLGMTRGQALRHVLLPQAIRTMTPSFVNQWVS
FT                   LIKDTSLAYIVGVPEFTFLANQVNSRLMVYPAQIFLFVGLVYLVLCCTFQWGVTRLLSG
FT                   AFDAGAARR"
     MSAVDWLPIL RYLLAGAFPN GPLGGIALTV MLTLTSAALS ALLGLAGGVS LVMTRGLPHL        60
     LLLAVVGLFR AIPVLMLIFW TFFLMPVLLH VDVPGLATVV CALALIGGAY LSHSVQAGIV       120
     AVGDGQWQAA QSLGMTRGQA LRHVLLPQAI RTMTPSFVNQ WVSLIKDTSL AYIVGVPEFT       180
     FLANQVNSRL MVYPAQIFLF VGLVYLVLCC TFQWGVTRLL SGAFDAGAAR R                231
//

If you have problems or comments...

PBIL Back to PBIL home page