(data stored in ACNUC7421 zone)

EMBL: CP000272.PE130

CP000272.PE130       Location/Qualifiers
FT   CDS             complement(145961..146812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0133"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36058"
FT                   /db_xref="GOA:Q13IN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IN1"
FT                   /protein_id="ABE36058.1"
FT                   /translation="MSETAIPVATAAGGDARSQHKARRTGERLRSVAWLLAPWLLPAAL
FT                   LALWTIGCERGWIAPQILPPPARVYETFMELAHSGDLVRHTLISLQRVVVGFGIGTMGG
FT                   FAIGAALGLSRTLEAYVLPGFNALVQIPVLGWLPFLLLLVGVGEPLKYILIAHAALVPA
FT                   TLSTLQGFRQSPHSLEEVARGYGYSEWQRIVYVVLPAAVPTLATGVRLAFTKAWLALVV
FT                   VELVASSEGLGYLIVYGRQLFQLDLVMASVVVVGAIGLVVNRLLDSLEARLRRGQPSAF
FT                   RE"
     MSETAIPVAT AAGGDARSQH KARRTGERLR SVAWLLAPWL LPAALLALWT IGCERGWIAP        60
     QILPPPARVY ETFMELAHSG DLVRHTLISL QRVVVGFGIG TMGGFAIGAA LGLSRTLEAY       120
     VLPGFNALVQ IPVLGWLPFL LLLVGVGEPL KYILIAHAAL VPATLSTLQG FRQSPHSLEE       180
     VARGYGYSEW QRIVYVVLPA AVPTLATGVR LAFTKAWLAL VVVELVASSE GLGYLIVYGR       240
     QLFQLDLVMA SVVVVGAIGL VVNRLLDSLE ARLRRGQPSA FRE                         283
//

If you have problems or comments...

PBIL Back to PBIL home page