(data stored in ACNUC7421 zone)

EMBL: CP000272.PE134

CP000272.PE134       Location/Qualifiers
FT   CDS             150312..151529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0137"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36062"
FT                   /db_xref="GOA:Q13IM7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM7"
FT                   /protein_id="ABE36062.1"
FT                   /translation="MQASLDTAAPPTLHAALAALPALARAIGEDAAQREARRELPFDRF
FT                   ALFRQSGLGLLRFPAEWGGLGGSLEDLFHVVATLAAEESNVAHALRIHYDLTEQLLLSP
FT                   RSAFNDTQIERVRQGAIFGGASTELGTSRPGEIVTALVRDGEHFRVTGKKYYSTGTAFS
FT                   DYARINVQDENDEKASIVIPVDREGVRVLDDWDGMGQRMTASGSLVLDNVQVFAHEVAT
FT                   RGYTSLAGRHGSAVRQLHLVAVAAGIVRNILADARRYVVHYGRPVLHSPAPSAREDGFV
FT                   QQVVGDLAAHSLAVDALVQQNARTLDQSANAIRSGAANAEERVLEGALATAKTQLVVSK
FT                   LALHAGERLFEIGGASATARSHNFDRHWRNLRTIFSHNPLLHKARVIGDYELNGVTTHL
FT                   TEGRVF"
     MQASLDTAAP PTLHAALAAL PALARAIGED AAQREARREL PFDRFALFRQ SGLGLLRFPA        60
     EWGGLGGSLE DLFHVVATLA AEESNVAHAL RIHYDLTEQL LLSPRSAFND TQIERVRQGA       120
     IFGGASTELG TSRPGEIVTA LVRDGEHFRV TGKKYYSTGT AFSDYARINV QDENDEKASI       180
     VIPVDREGVR VLDDWDGMGQ RMTASGSLVL DNVQVFAHEV ATRGYTSLAG RHGSAVRQLH       240
     LVAVAAGIVR NILADARRYV VHYGRPVLHS PAPSAREDGF VQQVVGDLAA HSLAVDALVQ       300
     QNARTLDQSA NAIRSGAANA EERVLEGALA TAKTQLVVSK LALHAGERLF EIGGASATAR       360
     SHNFDRHWRN LRTIFSHNPL LHKARVIGDY ELNGVTTHLT EGRVF                       405
//

If you have problems or comments...

PBIL Back to PBIL home page