(data stored in ACNUC7421 zone)

EMBL: CP000272.PE135

CP000272.PE135       Location/Qualifiers
FT   CDS             151584..151928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0138"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36063"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM6"
FT                   /protein_id="ABE36063.1"
FT                   /translation="MSRDLLLLLEPGFTDPNRPGERFICPDGAPIEGLLASDPALNARL
FT                   DIHRLPFTRPRAAVVEALDAEHQGLPVLIFGDEQPAPADAQTLGDKRFVTDTRRILELL
FT                   AQRHGFPKVH"
     MSRDLLLLLE PGFTDPNRPG ERFICPDGAP IEGLLASDPA LNARLDIHRL PFTRPRAAVV        60
     EALDAEHQGL PVLIFGDEQP APADAQTLGD KRFVTDTRRI LELLAQRHGF PKVH             114
//

If you have problems or comments...

PBIL Back to PBIL home page