(data stored in SCRATCH zone)

EMBL: CP000272.PE138

CP000272.PE138       Location/Qualifiers
FT   CDS             154096..155076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0141"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36066"
FT                   /db_xref="GOA:Q13IM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM3"
FT                   /protein_id="ABE36066.1"
FT                   /translation="MSRSLRVGAIARRTAWQVLPTVVGIVILNFFLLKLMPGDAADVLA
FT                   GESGSATAETMQVLRAKFGLDQPVLHQLWSYLTHLSHFSLGYSPRYDMPVMQLILSRLP
FT                   NTLFLMGVALSLAIVAGVTLGAVMAHWAGKWPDRLLSVLALLFYSTPGFWIGLLAIVLF
FT                   SVHLGWLPSGGNITLGVQLHGVAYLADAAKHVLLPAATLATFFVAIYARLTRAAMLEVQ
FT                   RQDFVRTAQAKGLHPWRVTVRHVLRNALMPLTTIVGIHFGTLLGGAAVTETVFSWPGLG
FT                   RLALDAVMARDFSVLLGVLLLSSLLVIVANVLVDLLQAWLDPRIA"
     MSRSLRVGAI ARRTAWQVLP TVVGIVILNF FLLKLMPGDA ADVLAGESGS ATAETMQVLR        60
     AKFGLDQPVL HQLWSYLTHL SHFSLGYSPR YDMPVMQLIL SRLPNTLFLM GVALSLAIVA       120
     GVTLGAVMAH WAGKWPDRLL SVLALLFYST PGFWIGLLAI VLFSVHLGWL PSGGNITLGV       180
     QLHGVAYLAD AAKHVLLPAA TLATFFVAIY ARLTRAAMLE VQRQDFVRTA QAKGLHPWRV       240
     TVRHVLRNAL MPLTTIVGIH FGTLLGGAAV TETVFSWPGL GRLALDAVMA RDFSVLLGVL       300
     LLSSLLVIVA NVLVDLLQAW LDPRIA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page