(data stored in ACNUC7421 zone)

EMBL: CP000272.PE139

CP000272.PE139       Location/Qualifiers
FT   CDS             155141..156112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0142"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36067"
FT                   /db_xref="GOA:Q13IM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM2"
FT                   /protein_id="ABE36067.1"
FT                   /translation="MASDSPDLISSSPEPGASSWRRQLAGTLFGQRRAGAARAPGPQRT
FT                   GRGVWRALLRNPSALAGLVLFTAFIALALGAGHLFPGDPLDMVAAPFEWPGADPQYWLG
FT                   TDSLGRDVAAGIAHGTRVSLLIGAAAAAIGLVIGTLVGAAGGFFGGVVDNVLVRVTELF
FT                   QTIPSFLLVIVIVAIGRPGVTVIALAIGIASWPTVARIVRAEFRTLREADFVLAARSQG
FT                   FSNARIIFGEILPNALPPVIVTASVMVASAILIESSLSFLGMGDPNVVSWGGMIGAGRD
FT                   SLRTAWYLTAIPGTAIVVAVLSLNLLGDGLNDALNPRLRERT"
     MASDSPDLIS SSPEPGASSW RRQLAGTLFG QRRAGAARAP GPQRTGRGVW RALLRNPSAL        60
     AGLVLFTAFI ALALGAGHLF PGDPLDMVAA PFEWPGADPQ YWLGTDSLGR DVAAGIAHGT       120
     RVSLLIGAAA AAIGLVIGTL VGAAGGFFGG VVDNVLVRVT ELFQTIPSFL LVIVIVAIGR       180
     PGVTVIALAI GIASWPTVAR IVRAEFRTLR EADFVLAARS QGFSNARIIF GEILPNALPP       240
     VIVTASVMVA SAILIESSLS FLGMGDPNVV SWGGMIGAGR DSLRTAWYLT AIPGTAIVVA       300
     VLSLNLLGDG LNDALNPRLR ERT                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page