(data stored in ACNUC7421 zone)

EMBL: CP000272.PE140

CP000272.PE140       Location/Qualifiers
FT   CDS             156115..157854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0143"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36068"
FT                   /db_xref="GOA:Q13IM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IM1"
FT                   /protein_id="ABE36068.1"
FT                   /translation="MTPRTHEVDRAANLLEVRDLRVSFGAHEAVRGLNFEVAQGETLAL
FT                   VGESGCGKSATALSLMRLVPAPAQVTGSVCFDGRELLDLSAPEIRAVRGRQISMIFQEP
FT                   MTSLNPVLSIGAQIVETLRQHERLSKAAAWKRAIELLELVRIPEPQRRVFDYPHELSGG
FT                   QRQRVMIAMAVACRPRLLIADEPTTALDVTIQARILELLDGLRRELSMSLLLITHDLGV
FT                   VAQHADRVAVMLAGELVEEAPVEQLFTRPGHAYTQGLLGASLNLADDLHYQGWKLPEIR
FT                   HGIADDGKPTFAVVPRSARTGQYVTQTAVRSAAHDDAPLLALHDVRIDYPHRHGKSTLR
FT                   AVDGVSLQIARGETVGLVGESGCGKSTLSKAILRLIPATRGQIRLRGTDLVPLRERELR
FT                   PLRRHVQMVFQDPYASLNPRRTVGEILNTVLVVNGVDDARQRQLRIAAILDRVGLPGSA
FT                   LGRFPHEFSGGQRQRIGIARALVLEPDLLICDEPVSALDVSIQAQILNLLVELKRDLGL
FT                   AYLFISHDLSVVRYIADRVHVMQAGRIVESGDHREIWRAPQHAYTRTLLEAIPGRSFDA
FT                   QAA"
     MTPRTHEVDR AANLLEVRDL RVSFGAHEAV RGLNFEVAQG ETLALVGESG CGKSATALSL        60
     MRLVPAPAQV TGSVCFDGRE LLDLSAPEIR AVRGRQISMI FQEPMTSLNP VLSIGAQIVE       120
     TLRQHERLSK AAAWKRAIEL LELVRIPEPQ RRVFDYPHEL SGGQRQRVMI AMAVACRPRL       180
     LIADEPTTAL DVTIQARILE LLDGLRRELS MSLLLITHDL GVVAQHADRV AVMLAGELVE       240
     EAPVEQLFTR PGHAYTQGLL GASLNLADDL HYQGWKLPEI RHGIADDGKP TFAVVPRSAR       300
     TGQYVTQTAV RSAAHDDAPL LALHDVRIDY PHRHGKSTLR AVDGVSLQIA RGETVGLVGE       360
     SGCGKSTLSK AILRLIPATR GQIRLRGTDL VPLRERELRP LRRHVQMVFQ DPYASLNPRR       420
     TVGEILNTVL VVNGVDDARQ RQLRIAAILD RVGLPGSALG RFPHEFSGGQ RQRIGIARAL       480
     VLEPDLLICD EPVSALDVSI QAQILNLLVE LKRDLGLAYL FISHDLSVVR YIADRVHVMQ       540
     AGRIVESGDH REIWRAPQHA YTRTLLEAIP GRSFDAQAA                              579
//

If you have problems or comments...

PBIL Back to PBIL home page