(data stored in ACNUC7421 zone)

EMBL: CP000272.PE142

CP000272.PE142       Location/Qualifiers
FT   CDS             complement(158781..159131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36070"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL9"
FT                   /protein_id="ABE36070.1"
FT                   /translation="MEYRQLGCCGIKVSTLTLGTMMFGSPTDEAAAARIIDLAHEQRIN
FT                   RRLQQTEWRTEAQWHDYLPALCYRLTAEDTAFVDSLVASGQPSTPEFNDPGRPFCGRIA
FT                   RRGAPQDEPYCA"
     MEYRQLGCCG IKVSTLTLGT MMFGSPTDEA AAARIIDLAH EQRINRRLQQ TEWRTEAQWH        60
     DYLPALCYRL TAEDTAFVDS LVASGQPSTP EFNDPGRPFC GRIARRGAPQ DEPYCA           116
//

If you have problems or comments...

PBIL Back to PBIL home page