(data stored in SCRATCH zone)

EMBL: CP000272.PE143

CP000272.PE143       Location/Qualifiers
FT   CDS             complement(159170..160789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0146"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36071"
FT                   /db_xref="GOA:Q13IL8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL8"
FT                   /protein_id="ABE36071.1"
FT                   /translation="MAHVTTQAALRRYGKRVLSGTLGFAMTLVVALASQASQAQTRGGT
FT                   LNFVVTPEPTALVDLATTATNVLKVSPKVTEGLLEYDFNFAPKPSLATSWEISDDSRKY
FT                   VFHLRHGVKWHDGKPFTSADVAYSIQTLRQVHPRAKTTFANVTHIATPDPYTVIITLSR
FT                   SAPWLIKAFSSSETPIVPKHVYDGTDVLANPANNAPIGTGPFRFVRWVRGSYIEYARND
FT                   DYWDKGKPWLDRIVVKIINDPAARTVAFEDGSVDLSGDTPVPLSDLARLKDNPKLGIES
FT                   RGYEFQAGVARIEFNLDNPLLKDPKVRQAIASALDREVIRKVIYYGYATPLASPIIPSN
FT                   PYHDPAPTPYPFNVEHANGLLDQAGYPRKADGTRFALTVDPLPIGDLPARTAAYVKSAL
FT                   ARVGIAVTVRSQDLPAYLKRIYTDRDFDFSINGMSNLFDPVVGVARLYTTGNFRRGVPF
FT                   TNGSHYSNPEIDQLFSQVAEETDEVKRRQLFSQIQRIVERDLPDINLVSPQYITVYSRA
FT                   VHNHTISPDGVSASFADLWLQH"
     MAHVTTQAAL RRYGKRVLSG TLGFAMTLVV ALASQASQAQ TRGGTLNFVV TPEPTALVDL        60
     ATTATNVLKV SPKVTEGLLE YDFNFAPKPS LATSWEISDD SRKYVFHLRH GVKWHDGKPF       120
     TSADVAYSIQ TLRQVHPRAK TTFANVTHIA TPDPYTVIIT LSRSAPWLIK AFSSSETPIV       180
     PKHVYDGTDV LANPANNAPI GTGPFRFVRW VRGSYIEYAR NDDYWDKGKP WLDRIVVKII       240
     NDPAARTVAF EDGSVDLSGD TPVPLSDLAR LKDNPKLGIE SRGYEFQAGV ARIEFNLDNP       300
     LLKDPKVRQA IASALDREVI RKVIYYGYAT PLASPIIPSN PYHDPAPTPY PFNVEHANGL       360
     LDQAGYPRKA DGTRFALTVD PLPIGDLPAR TAAYVKSALA RVGIAVTVRS QDLPAYLKRI       420
     YTDRDFDFSI NGMSNLFDPV VGVARLYTTG NFRRGVPFTN GSHYSNPEID QLFSQVAEET       480
     DEVKRRQLFS QIQRIVERDL PDINLVSPQY ITVYSRAVHN HTISPDGVSA SFADLWLQH        539
//

If you have problems or comments...

PBIL Back to PBIL home page