(data stored in ACNUC7421 zone)

EMBL: CP000272.PE149

CP000272.PE149       Location/Qualifiers
FT   CDS             166532..167119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0152"
FT                   /product="Putative sulfite oxidase cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36077"
FT                   /db_xref="GOA:Q13IL2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IL2"
FT                   /protein_id="ABE36077.1"
FT                   /translation="MREGRSRCVRMHAALAAFLLLMALASCSSIAPDAPGAQNATAGHD
FT                   IGTPVTAQELAAWNIDVAPDGRGLPPGSGDVATGAHVFAAKCAACHGAQGQGGLGDPLV
FT                   GGQGTLASAKPKRTVGSYWPYATTLFDYIRRAMPYNAPESLSADEVYALSAFLLNQNGI
FT                   VAANTRLDAASLPRVVMPNRNGFVIDPRPARL"
     MREGRSRCVR MHAALAAFLL LMALASCSSI APDAPGAQNA TAGHDIGTPV TAQELAAWNI        60
     DVAPDGRGLP PGSGDVATGA HVFAAKCAAC HGAQGQGGLG DPLVGGQGTL ASAKPKRTVG       120
     SYWPYATTLF DYIRRAMPYN APESLSADEV YALSAFLLNQ NGIVAANTRL DAASLPRVVM       180
     PNRNGFVIDP RPARL                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page