(data stored in SCRATCH zone)

EMBL: CP000272.PE152

CP000272.PE152       Location/Qualifiers
FT   CDS             169400..170230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0155"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36080"
FT                   /db_xref="GOA:Q13IK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK9"
FT                   /protein_id="ABE36080.1"
FT                   /translation="MVANPTLLFPDSAGHPGAATSAKLLAVEHVNLEYRTRERIVRATH
FT                   DVSFDVYGGDRFVLLGPSGCGKSTLLKAVAGFIQPTSGSISLDGQHVRGPGADRIVVFQ
FT                   EFDQLPPWKTVLQNVVFPLRVAKKLSRAEARERALHYLEKVGLASFANAYPHTLSGGMK
FT                   QRVAIARALAMQPRVLLMDEPFAALDALTRRKMQEELLRLWEEVNFTLLFVTHSIEEAL
FT                   VVGNRILLLSPHPGRVRAELNSHQYSQDSFGRSDFQRSAAHIHHLLFEQTETVQ"
     MVANPTLLFP DSAGHPGAAT SAKLLAVEHV NLEYRTRERI VRATHDVSFD VYGGDRFVLL        60
     GPSGCGKSTL LKAVAGFIQP TSGSISLDGQ HVRGPGADRI VVFQEFDQLP PWKTVLQNVV       120
     FPLRVAKKLS RAEARERALH YLEKVGLASF ANAYPHTLSG GMKQRVAIAR ALAMQPRVLL       180
     MDEPFAALDA LTRRKMQEEL LRLWEEVNFT LLFVTHSIEE ALVVGNRILL LSPHPGRVRA       240
     ELNSHQYSQD SFGRSDFQRS AAHIHHLLFE QTETVQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page