(data stored in ACNUC7421 zone)

EMBL: CP000272.PE156

CP000272.PE156       Location/Qualifiers
FT   CDS             complement(172810..173814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0159"
FT                   /product="ABC aliphatic sulfonates transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36084"
FT                   /db_xref="GOA:Q13IK5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK5"
FT                   /protein_id="ABE36084.1"
FT                   /translation="MTLMTRRAFTRAMLAAALTITGTQGHAQASRTAGSPVALRIGYQK
FT                   SSTLITLLKARGSLEQALAPLGVNVSWHEFASGLPLTEALNVDAVDFSADVADTVPVFA
FT                   QAAHANFVYIAQEAPSPGAQAIIVRKDGPLHTLADLKGKHIAVTKAAGSHYLLLAALAK
FT                   AGLSPADVTIHYLAPADGRAAFEHGSVDAWITWDPYVASVDRDTSVRILADGNGLASYQ
FT                   RYYLASSNFAAAHPAVIQILFDQLSQAGTWLRTHPEDAAKTLSPIWGLDTTTIERANAR
FT                   RSYVVRPVVPQNFSEQQKIADTFLQAGLLPARVDTGEAQRWDFATKRAEPAGS"
     MTLMTRRAFT RAMLAAALTI TGTQGHAQAS RTAGSPVALR IGYQKSSTLI TLLKARGSLE        60
     QALAPLGVNV SWHEFASGLP LTEALNVDAV DFSADVADTV PVFAQAAHAN FVYIAQEAPS       120
     PGAQAIIVRK DGPLHTLADL KGKHIAVTKA AGSHYLLLAA LAKAGLSPAD VTIHYLAPAD       180
     GRAAFEHGSV DAWITWDPYV ASVDRDTSVR ILADGNGLAS YQRYYLASSN FAAAHPAVIQ       240
     ILFDQLSQAG TWLRTHPEDA AKTLSPIWGL DTTTIERANA RRSYVVRPVV PQNFSEQQKI       300
     ADTFLQAGLL PARVDTGEAQ RWDFATKRAE PAGS                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page