(data stored in ACNUC7421 zone)

EMBL: CP000272.PE158

CP000272.PE158       Location/Qualifiers
FT   CDS             175695..177284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0161"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36086"
FT                   /db_xref="GOA:Q13IK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK3"
FT                   /protein_id="ABE36086.1"
FT                   /translation="MSLRNSSRGYVFGALSAFILICASSLPVLAAPNHGGTLTWLVTPE
FT                   PASIIPLTSTAGGNAEIGPKVVEGLLTYDKDLNPQPLLATAWSVSKDGLEYRFTLRRGV
FT                   KWHDGKPFTSADVAFSILTLKQVHPRGRSTFANVVDVRTPDPYTATIQLSKPAPFLLTA
FT                   LSGSESPIIPKHLYEGTDIVSNPYNSAPVGTGPFVFKSFVHGSYILLERNPDYWDKPKP
FT                   YLDKIVVRFLPDAAARAAALESGAANLGDQAIPLSDVKRFSALPEFKVDTTNWPYVSNH
FT                   QQLIFNLDTPVLKDKAVRKAISQAVDVNALNRVVWYGYGQVSAAAIGAANTKYHDADIH
FT                   YFPYDIAQANAALDAAGLKRGPDGKRFTLRLLFNPFQDPRAADFVRQSLARIGIDGEIE
FT                   SYDFATYVKKAYTDRAFDITLEALANVFDPTVGVQRVFWSKNFKIGLPFSNAAHYSNPE
FT                   VDRLLEAASAETNEAKRRQLFIQFQQIVHDDIPSIEFGANPNITIVSKKVKDYAPTGEG
FT                   LRGNFSDLYIEP"
     MSLRNSSRGY VFGALSAFIL ICASSLPVLA APNHGGTLTW LVTPEPASII PLTSTAGGNA        60
     EIGPKVVEGL LTYDKDLNPQ PLLATAWSVS KDGLEYRFTL RRGVKWHDGK PFTSADVAFS       120
     ILTLKQVHPR GRSTFANVVD VRTPDPYTAT IQLSKPAPFL LTALSGSESP IIPKHLYEGT       180
     DIVSNPYNSA PVGTGPFVFK SFVHGSYILL ERNPDYWDKP KPYLDKIVVR FLPDAAARAA       240
     ALESGAANLG DQAIPLSDVK RFSALPEFKV DTTNWPYVSN HQQLIFNLDT PVLKDKAVRK       300
     AISQAVDVNA LNRVVWYGYG QVSAAAIGAA NTKYHDADIH YFPYDIAQAN AALDAAGLKR       360
     GPDGKRFTLR LLFNPFQDPR AADFVRQSLA RIGIDGEIES YDFATYVKKA YTDRAFDITL       420
     EALANVFDPT VGVQRVFWSK NFKIGLPFSN AAHYSNPEVD RLLEAASAET NEAKRRQLFI       480
     QFQQIVHDDI PSIEFGANPN ITIVSKKVKD YAPTGEGLRG NFSDLYIEP                   529
//

If you have problems or comments...

PBIL Back to PBIL home page