(data stored in ACNUC7421 zone)

EMBL: CP000272.PE16

CP000272.PE16        Location/Qualifiers
FT   CDS             complement(21847..22848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0017"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35944"
FT                   /db_xref="GOA:Q13IZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ5"
FT                   /protein_id="ABE35944.1"
FT                   /translation="MHTIKPFYFPTTVTFVDDSAAFLSNLCLQLDPQLAFRLFSSPGEA
FT                   LEFVNSRPRPGPSDEPLFAPFRDRTDEDLAHQVIALSVNTVRKQVHNAQRFLATSVVVV
FT                   DYDMPGMNGLEFCRRMTDPAVRKIMLTGKADEHIAVQSFNEGIIHRFIRKQDASAVPAL
FT                   NRAVRDLQNAYFDDVCQSILDTLAVSEYAFLRDEALAARVAELAASLGIVEHYLSYCPG
FT                   GLLMLDSAGKSYLLIVHTDETLRGLREIAVEQEAPAEFLAALDSRRSLPYFWQTEGHYP
FT                   ADCTAWENYMHPATQFSGRQNYVYAVIPNPPGLDLSQVLSYDRYLERLDRDL"
     MHTIKPFYFP TTVTFVDDSA AFLSNLCLQL DPQLAFRLFS SPGEALEFVN SRPRPGPSDE        60
     PLFAPFRDRT DEDLAHQVIA LSVNTVRKQV HNAQRFLATS VVVVDYDMPG MNGLEFCRRM       120
     TDPAVRKIML TGKADEHIAV QSFNEGIIHR FIRKQDASAV PALNRAVRDL QNAYFDDVCQ       180
     SILDTLAVSE YAFLRDEALA ARVAELAASL GIVEHYLSYC PGGLLMLDSA GKSYLLIVHT       240
     DETLRGLREI AVEQEAPAEF LAALDSRRSL PYFWQTEGHY PADCTAWENY MHPATQFSGR       300
     QNYVYAVIPN PPGLDLSQVL SYDRYLERLD RDL                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page