(data stored in SCRATCH zone)

EMBL: CP000272.PE161

CP000272.PE161       Location/Qualifiers
FT   CDS             complement(178913..179434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0164"
FT                   /product="Competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36089"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK0"
FT                   /protein_id="ABE36089.1"
FT                   /translation="MNIPMQAVSFLSSRGLKLATAESCTAGQIASYLASVPGSGSCLDV
FT                   GFVSYSPSGKAGFLGVKESTMKQFGLTSEEVAREMAEGALRQEGCCADVVVSNTGLADP
FT                   AAAGSPPAGTQCFAWSFRMREANIVTFSETRRFSGGRNDVRSAAALYALSRIEHYFNQL
FT                   PSARRERHTR"
     MNIPMQAVSF LSSRGLKLAT AESCTAGQIA SYLASVPGSG SCLDVGFVSY SPSGKAGFLG        60
     VKESTMKQFG LTSEEVAREM AEGALRQEGC CADVVVSNTG LADPAAAGSP PAGTQCFAWS       120
     FRMREANIVT FSETRRFSGG RNDVRSAAAL YALSRIEHYF NQLPSARRER HTR              173
//

If you have problems or comments...

PBIL Back to PBIL home page