(data stored in ACNUC7421 zone)

EMBL: CP000272.PE162

CP000272.PE162       Location/Qualifiers
FT   CDS             179675..179878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36090"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ9"
FT                   /protein_id="ABE36090.1"
FT                   /translation="MNKDQREGLKEELKGYVNKGIGSITGNEDRKVKGEVQITNGDNRK
FT                   DLGDQEDSIDRNAIDPGNPSNL"
     MNKDQREGLK EELKGYVNKG IGSITGNEDR KVKGEVQITN GDNRKDLGDQ EDSIDRNAID        60
     PGNPSNL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page