(data stored in ACNUC7421 zone)

EMBL: CP000272.PE164

CP000272.PE164       Location/Qualifiers
FT   CDS             181592..182707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0167"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36092"
FT                   /db_xref="GOA:Q13IJ7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ7"
FT                   /protein_id="ABE36092.1"
FT                   /translation="MIPGVGFDMCAAAPQCSMGAWPRRRRLGPLAAVSLCPMSYVAKVG
FT                   AQPQQSALQPAGVQAAHIAKLWNLSLIVCGIVFALVLLATLVALIRNGRHAATPAQTTQ
FT                   PPDLSSLTRPEHRTRRIVIGVSVMSVIVLVGLIVADVLTDRALSKLPVDDPLRIDMVGA
FT                   QWWWQASYRPEGGRPGFVTANELHVPVGRPIVVSLQAADVIHSFWVPNLHGKKDLLPGI
FT                   DTTIEFRADQPGVYRGQCAEYCGAEHALMAMLVVAEPRERYAAWVARQARPAAQSADAV
FT                   ALQGRAVFERASCAHCHTVRGSSAQGTPGPDLTHLMSRETIAAGVLANTPQNLAAWIRD
FT                   PDALKPGTTMPAVPLSDTDRVAVVRWLRTLQ"
     MIPGVGFDMC AAAPQCSMGA WPRRRRLGPL AAVSLCPMSY VAKVGAQPQQ SALQPAGVQA        60
     AHIAKLWNLS LIVCGIVFAL VLLATLVALI RNGRHAATPA QTTQPPDLSS LTRPEHRTRR       120
     IVIGVSVMSV IVLVGLIVAD VLTDRALSKL PVDDPLRIDM VGAQWWWQAS YRPEGGRPGF       180
     VTANELHVPV GRPIVVSLQA ADVIHSFWVP NLHGKKDLLP GIDTTIEFRA DQPGVYRGQC       240
     AEYCGAEHAL MAMLVVAEPR ERYAAWVARQ ARPAAQSADA VALQGRAVFE RASCAHCHTV       300
     RGSSAQGTPG PDLTHLMSRE TIAAGVLANT PQNLAAWIRD PDALKPGTTM PAVPLSDTDR       360
     VAVVRWLRTL Q                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page