(data stored in ACNUC7421 zone)

EMBL: CP000272.PE167

CP000272.PE167       Location/Qualifiers
FT   CDS             185675..186673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0170"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36095"
FT                   /db_xref="GOA:Q13IJ4"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ4"
FT                   /protein_id="ABE36095.1"
FT                   /translation="MTARLHAACRVAGRARERGARAGVCAGLLALAHAPLACAHVLTGA
FT                   ERAAPTFGWSFDAWVVVLMLASTLAYAVGYVRLRLRGSPRSRATRAWHASAFAAGMAAL
FT                   VFALCSPLDSLSAALFSAHMVQHETMMLIAAPLLVLGRPLGVWIWALPRAARRRIGRAV
FT                   RAPAVARAWRGLTAPLAGWTLHAAALWGWHAPVMFEAALAHPWVHTLQHTSFMLTALVF
FT                   WWTVFGDGASRQSGGHAMLSVFTTMVHTSALGALISLAPGLWYPSYVEPTSALGIDPLH
FT                   DQQAGGLIMWVPGAMAYLIGGLAIAARWLRGHEPPRVIADPAAALPQDGGR"
     MTARLHAACR VAGRARERGA RAGVCAGLLA LAHAPLACAH VLTGAERAAP TFGWSFDAWV        60
     VVLMLASTLA YAVGYVRLRL RGSPRSRATR AWHASAFAAG MAALVFALCS PLDSLSAALF       120
     SAHMVQHETM MLIAAPLLVL GRPLGVWIWA LPRAARRRIG RAVRAPAVAR AWRGLTAPLA       180
     GWTLHAAALW GWHAPVMFEA ALAHPWVHTL QHTSFMLTAL VFWWTVFGDG ASRQSGGHAM       240
     LSVFTTMVHT SALGALISLA PGLWYPSYVE PTSALGIDPL HDQQAGGLIM WVPGAMAYLI       300
     GGLAIAARWL RGHEPPRVIA DPAAALPQDG GR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page