(data stored in ACNUC7421 zone)

EMBL: CP000272.PE17

CP000272.PE17        Location/Qualifiers
FT   CDS             complement(22851..24080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0018"
FT                   /product="seriplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35945"
FT                   /db_xref="GOA:Q13IZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ4"
FT                   /protein_id="ABE35945.1"
FT                   /translation="MRPFAMVAIVGFPLYFYVWHALFPQPYENLPLRLVGSALFIPILF
FT                   SDRWPARTRKFLPYYWYATIFYSLPFFFTFMLLKNNGSNVWIESALIAAFVMVLLLDWF
FT                   MLLLNFVTGIGVAYLAYWLTTDPVVLHAAYAAHLAIFSFAVAIGVVANYDMDRIRIEQE
FT                   RAMLATASSIAHELRTPLLAIRAGASGLGHYLPSLLETYSIAQQSDLPVPKIRLVHLQS
FT                   MDGVLSRIEQEAIHSNAIIDMLLANARFTGGYTHGAAVCSIAQSVRTALERYPFREGER
FT                   ERVLTDLAMDFTFHGSEMLMVHVLFNLLKNALRGMASVDSALISIRLVSGPRTNQLLFR
FT                   DTGAGIAPDVLPHIFTRFYTSSAGIDDASIGTGIGLAFCRDVMRGVGGAIDCKSVEGMF
FT                   TEFVLTFPRP"
     MRPFAMVAIV GFPLYFYVWH ALFPQPYENL PLRLVGSALF IPILFSDRWP ARTRKFLPYY        60
     WYATIFYSLP FFFTFMLLKN NGSNVWIESA LIAAFVMVLL LDWFMLLLNF VTGIGVAYLA       120
     YWLTTDPVVL HAAYAAHLAI FSFAVAIGVV ANYDMDRIRI EQERAMLATA SSIAHELRTP       180
     LLAIRAGASG LGHYLPSLLE TYSIAQQSDL PVPKIRLVHL QSMDGVLSRI EQEAIHSNAI       240
     IDMLLANARF TGGYTHGAAV CSIAQSVRTA LERYPFREGE RERVLTDLAM DFTFHGSEML       300
     MVHVLFNLLK NALRGMASVD SALISIRLVS GPRTNQLLFR DTGAGIAPDV LPHIFTRFYT       360
     SSAGIDDASI GTGIGLAFCR DVMRGVGGAI DCKSVEGMFT EFVLTFPRP                   409
//

If you have problems or comments...

PBIL Back to PBIL home page