(data stored in ACNUC7421 zone)

EMBL: CP000272.PE171

CP000272.PE171       Location/Qualifiers
FT   CDS             complement(192603..193130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0174"
FT                   /product="Putative hydrogenase/oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36099"
FT                   /db_xref="GOA:Q13IJ0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ0"
FT                   /protein_id="ABE36099.1"
FT                   /translation="MWQLLKQIARTGTPDPRVPESDDAWRTESQQIQQDILDLLGRALC
FT                   IREIDAGSCNGCELEIHALNNPYYNLEGLGIRFVASPRHADMLLVTGPLTVNMTEAVRL
FT                   AYEATPDPKLVVATGECACTGGMFKESYAVCGPLAKLLPVDVTIPGCPPPPLDILRGIL
FT                   GALRVKRTTRAR"
     MWQLLKQIAR TGTPDPRVPE SDDAWRTESQ QIQQDILDLL GRALCIREID AGSCNGCELE        60
     IHALNNPYYN LEGLGIRFVA SPRHADMLLV TGPLTVNMTE AVRLAYEATP DPKLVVATGE       120
     CACTGGMFKE SYAVCGPLAK LLPVDVTIPG CPPPPLDILR GILGALRVKR TTRAR            175
//

If you have problems or comments...

PBIL Back to PBIL home page