(data stored in SCRATCH zone)

EMBL: CP000272.PE174

CP000272.PE174       Location/Qualifiers
FT   CDS             complement(196155..196814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0177"
FT                   /product="Putative membrane protein"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36102"
FT                   /db_xref="GOA:Q13II7"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II7"
FT                   /protein_id="ABE36102.1"
FT                   /translation="MHGFATQIINFLAAILLLLSFAMLSQRRILSLIHLYTLQGLTLVS
FT                   ANVTLGYVTADVHLYISAALTLVLKVGLIPWILYRLVQRLNVKADVEPLLNIPATLLIG
FT                   IVLVIVAFNVASPISQLASSVARGTLGIALACVLLSFMMMITRANAIPQVIGFLSMENG
FT                   LFFAAAAATNGMPMIVELGIGLDVLVGILILGVFMFQIREQFDSLDIHHLEKLKDD"
     MHGFATQIIN FLAAILLLLS FAMLSQRRIL SLIHLYTLQG LTLVSANVTL GYVTADVHLY        60
     ISAALTLVLK VGLIPWILYR LVQRLNVKAD VEPLLNIPAT LLIGIVLVIV AFNVASPISQ       120
     LASSVARGTL GIALACVLLS FMMMITRANA IPQVIGFLSM ENGLFFAAAA ATNGMPMIVE       180
     LGIGLDVLVG ILILGVFMFQ IREQFDSLDI HHLEKLKDD                              219
//

If you have problems or comments...

PBIL Back to PBIL home page