(data stored in ACNUC7421 zone)

EMBL: CP000272.PE175

CP000272.PE175       Location/Qualifiers
FT   CDS             complement(196815..197765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0178"
FT                   /product="Formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36103"
FT                   /db_xref="GOA:Q13II6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II6"
FT                   /protein_id="ABE36103.1"
FT                   /translation="MITLSGLLSQGLEILLALAAAPLLTGWVNLCRARLQNRRAPSIWQ
FT                   PYRMLHKLFNKESVVADHASPLFRGAPYVVWACMTLACAIVPTLSTDLPLSPAADAIAL
FT                   VGLFALARVMISLAAMDIGTAFGTLGARREMLVGFLAEPALLMVLFSASLITQSTLLTR
FT                   IVSTLSHRELAIYPSLAFAGIAFAMVSLAENARLPVDNPTTHLELTMIHEALILEYSGR
FT                   HLALMEWATSLKLFAYSCIGLALFIPWGIAEAGSPAALLLAIPALFIKLLTGGAALAVV
FT                   ETSNAKMRLFRVPEFLATAFLLAVIGMLVHFLLGA"
     MITLSGLLSQ GLEILLALAA APLLTGWVNL CRARLQNRRA PSIWQPYRML HKLFNKESVV        60
     ADHASPLFRG APYVVWACMT LACAIVPTLS TDLPLSPAAD AIALVGLFAL ARVMISLAAM       120
     DIGTAFGTLG ARREMLVGFL AEPALLMVLF SASLITQSTL LTRIVSTLSH RELAIYPSLA       180
     FAGIAFAMVS LAENARLPVD NPTTHLELTM IHEALILEYS GRHLALMEWA TSLKLFAYSC       240
     IGLALFIPWG IAEAGSPAAL LLAIPALFIK LLTGGAALAV VETSNAKMRL FRVPEFLATA       300
     FLLAVIGMLV HFLLGA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page