(data stored in ACNUC7421 zone)

EMBL: CP000272.PE178

CP000272.PE178       Location/Qualifiers
FT   CDS             201017..201778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0181"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36106"
FT                   /db_xref="GOA:Q13II3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II3"
FT                   /protein_id="ABE36106.1"
FT                   /translation="MPAHYFRSLTGKNRSTEADRQLGFSLAFVAGATNAGGFLAVKQYT
FT                   SHMSGVVSSIADQAALGDFSLVLAGAGSLISFLLGAACSAVLVNWGRRRRLHSQYASPL
FT                   LVEAVLLLCFGLLGSHLALWDTLFVPATVVLLCFIMGLQNAMITKLSGAGIRTTHMTGI
FT                   VTDIGIELGKLFYWNSAKADPGVSLVLANRGRLKVQGTMLAMFVVGGFTGAMGFKHIGY
FT                   ASTVPLAGVLIVLAIVPLVDDLRAQVYRLDR"
     MPAHYFRSLT GKNRSTEADR QLGFSLAFVA GATNAGGFLA VKQYTSHMSG VVSSIADQAA        60
     LGDFSLVLAG AGSLISFLLG AACSAVLVNW GRRRRLHSQY ASPLLVEAVL LLCFGLLGSH       120
     LALWDTLFVP ATVVLLCFIM GLQNAMITKL SGAGIRTTHM TGIVTDIGIE LGKLFYWNSA       180
     KADPGVSLVL ANRGRLKVQG TMLAMFVVGG FTGAMGFKHI GYASTVPLAG VLIVLAIVPL       240
     VDDLRAQVYR LDR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page