(data stored in ACNUC7421 zone)

EMBL: CP000272.PE181

CP000272.PE181       Location/Qualifiers
FT   CDS             complement(204379..206271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36109"
FT                   /db_xref="GOA:Q13II0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II0"
FT                   /protein_id="ABE36109.1"
FT                   /translation="MSTRDKEFPDLILHRGRFTTLDRNRPEATAVAIRQRVFTAVGSDA
FT                   EIVPLAGSATRVIDLLGLRVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLATAMDMLRA
FT                   QVAITPPPQWVRVVGGFTEHQFDEKRLPTIDELNAVAPDTPVFILHLYDRAILNAAALR
FT                   VVGYTKDTAEPPGGEIVRDSAGNPVGLLLAKPNAGILYATLAKGPKLPPEYQVNSTRHF
FT                   MRELNRLGVTGAIDAGGGFQNYPEDYAVIQKLSDAGQLTIRLAYNLFTQKPKGEKEDFL
FT                   NWTKTSKYKQGTDYFRHNGAGEMLVFSAADFEDFRQPRPDMTPDMEGELEGVVRVLAEN
FT                   RWPWRMHATYDETISRALDVFEKVNRDIPLNGLNWFFDHAETISERSIDRIAALGGGIA
FT                   VQHRMAYQGEYFVERYGAQAAEATPPVARMLEKGVRTSAGTDATRVASYNPWVALAWLV
FT                   TGKTLSGLRIYPQRNCLDRETALRMWTENVTWFSNEEGRKGRIETGQFADLIVPDHDYM
FT                   SCPESDIAGTTSLLTVVGGKIVYGAGPFAKFDAPLPPAMPDWSPVRAYGGYAGWGAAQG
FT                   KEGTPLQRAAAQQCGCAHACGLHGHAHARAWTNNVPAADLKSFWGALGCACWAV"
     MSTRDKEFPD LILHRGRFTT LDRNRPEATA VAIRQRVFTA VGSDAEIVPL AGSATRVIDL        60
     LGLRVLPGLI DNHLHIIRGG LNFNMELRWD GVRSLATAMD MLRAQVAITP PPQWVRVVGG       120
     FTEHQFDEKR LPTIDELNAV APDTPVFILH LYDRAILNAA ALRVVGYTKD TAEPPGGEIV       180
     RDSAGNPVGL LLAKPNAGIL YATLAKGPKL PPEYQVNSTR HFMRELNRLG VTGAIDAGGG       240
     FQNYPEDYAV IQKLSDAGQL TIRLAYNLFT QKPKGEKEDF LNWTKTSKYK QGTDYFRHNG       300
     AGEMLVFSAA DFEDFRQPRP DMTPDMEGEL EGVVRVLAEN RWPWRMHATY DETISRALDV       360
     FEKVNRDIPL NGLNWFFDHA ETISERSIDR IAALGGGIAV QHRMAYQGEY FVERYGAQAA       420
     EATPPVARML EKGVRTSAGT DATRVASYNP WVALAWLVTG KTLSGLRIYP QRNCLDRETA       480
     LRMWTENVTW FSNEEGRKGR IETGQFADLI VPDHDYMSCP ESDIAGTTSL LTVVGGKIVY       540
     GAGPFAKFDA PLPPAMPDWS PVRAYGGYAG WGAAQGKEGT PLQRAAAQQC GCAHACGLHG       600
     HAHARAWTNN VPAADLKSFW GALGCACWAV                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page