(data stored in ACNUC7421 zone)

EMBL: CP000272.PE182

CP000272.PE182       Location/Qualifiers
FT   CDS             complement(206268..206558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0185"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36110"
FT                   /db_xref="GOA:Q13IH9"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH9"
FT                   /protein_id="ABE36110.1"
FT                   /translation="MKLYIFSLLAGILVGVIYSLINVRSPAPPLVALVGLLGILAGEQL
FT                   IPVAKQMLSGSAFHTAWHESKCDQHMFGALPGRQTGDTSRTAAVNSPEKRS"
     MKLYIFSLLA GILVGVIYSL INVRSPAPPL VALVGLLGIL AGEQLIPVAK QMLSGSAFHT        60
     AWHESKCDQH MFGALPGRQT GDTSRTAAVN SPEKRS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page