(data stored in SCRATCH zone)

EMBL: CP000272.PE185

CP000272.PE185       Location/Qualifiers
FT   CDS             209147..209797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0188"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36113"
FT                   /db_xref="GOA:Q13IH6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH6"
FT                   /protein_id="ABE36113.1"
FT                   /translation="MRGRVSLTQPGENDVSSSSGHHRSDLDEYLGTPAACRPGECHRQA
FT                   AHRAGCLFGARRVAPAGRFDVSSSARQNPRWVDAILVQPWLLPLVRMALVSAYVIGGLA
FT                   KLANFHAAVLEQEHFGLHPGWLWAVFAIVVELGGSVCVIADRLVWLGAGGLGVLTMVAM
FT                   FVANDFWNQLGSARFMALNSFFEHLGLLAALVMATCVAGVKQSAGTAGVQKNP"
     MRGRVSLTQP GENDVSSSSG HHRSDLDEYL GTPAACRPGE CHRQAAHRAG CLFGARRVAP        60
     AGRFDVSSSA RQNPRWVDAI LVQPWLLPLV RMALVSAYVI GGLAKLANFH AAVLEQEHFG       120
     LHPGWLWAVF AIVVELGGSV CVIADRLVWL GAGGLGVLTM VAMFVANDFW NQLGSARFMA       180
     LNSFFEHLGL LAALVMATCV AGVKQSAGTA GVQKNP                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page