(data stored in ACNUC7421 zone)

EMBL: CP000272.PE187

CP000272.PE187       Location/Qualifiers
FT   CDS             210820..211410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0190"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36115"
FT                   /db_xref="GOA:Q13IH4"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH4"
FT                   /protein_id="ABE36115.1"
FT                   /translation="MKSEDSILAAIAGYVDTLGFVALFGVFTAHVTGNFVLIGAEVAGF
FT                   GQRAFMKLMALPAFIAGVVVSSVLLRSMQGATPSRAACVLYAVQAALTLAFCLAGVGVS
FT                   PVVHADGASVIVCGMVGAAAMGVQNAHSRLVSRPGMPDTVMTGNVTQVVPDMTDMLSPQ
FT                   TPPGIKVAARARIGKILPAVLAFATGAIAGAVA"
     MKSEDSILAA IAGYVDTLGF VALFGVFTAH VTGNFVLIGA EVAGFGQRAF MKLMALPAFI        60
     AGVVVSSVLL RSMQGATPSR AACVLYAVQA ALTLAFCLAG VGVSPVVHAD GASVIVCGMV       120
     GAAAMGVQNA HSRLVSRPGM PDTVMTGNVT QVVPDMTDML SPQTPPGIKV AARARIGKIL       180
     PAVLAFATGA IAGAVA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page