(data stored in ACNUC7421 zone)

EMBL: CP000272.PE188

CP000272.PE188       Location/Qualifiers
FT   CDS             211753..213216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36116"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH3"
FT                   /protein_id="ABE36116.1"
FT                   /translation="MTWVRPKPIAGKEAVAYLSIVVAGLAFGPSDGARAETDETAAVDE
FT                   AASACTAKRPVVLFNRWQEDWSVLANPCVPRQPLDSLKYIRLGGDPDSYLSLGANLRER
FT                   LETNNALLFGIGSGHADTYLIQRAQVSADARIGQHLQFFVQLADARAFGKDAVSSVDKN
FT                   PLDLEQAFVAWVSPLGPGVVKLRIGRQEMAFDLQRFISVRDGPNVRQAYDAIWADYEYQ
FT                   KWRFIGYATQPVQYRNTTVFDDVSNRHLTFSGVRFERQEVGPGDLSGYYSRYNRSNARF
FT                   LDATGDEHRDVFDLRYTGKTGRTDWDVESMFQSGHVGTRTIGAWAVGSLAGYTLDLPGA
FT                   PRVGVQIDAASGDRHPGDGRVETFNPLFPNGYYFTLAGYTGYANLVHVKPSITLRPTSK
FT                   LSLLGALGFQWRETTADAVYQQANAVVPGTAGHGSRWTGMYVQLRADWTIASNLTGSVE
FT                   AVHFQVGDSIRNAGGSNSDYVGVEMKYGW"
     MTWVRPKPIA GKEAVAYLSI VVAGLAFGPS DGARAETDET AAVDEAASAC TAKRPVVLFN        60
     RWQEDWSVLA NPCVPRQPLD SLKYIRLGGD PDSYLSLGAN LRERLETNNA LLFGIGSGHA       120
     DTYLIQRAQV SADARIGQHL QFFVQLADAR AFGKDAVSSV DKNPLDLEQA FVAWVSPLGP       180
     GVVKLRIGRQ EMAFDLQRFI SVRDGPNVRQ AYDAIWADYE YQKWRFIGYA TQPVQYRNTT       240
     VFDDVSNRHL TFSGVRFERQ EVGPGDLSGY YSRYNRSNAR FLDATGDEHR DVFDLRYTGK       300
     TGRTDWDVES MFQSGHVGTR TIGAWAVGSL AGYTLDLPGA PRVGVQIDAA SGDRHPGDGR       360
     VETFNPLFPN GYYFTLAGYT GYANLVHVKP SITLRPTSKL SLLGALGFQW RETTADAVYQ       420
     QANAVVPGTA GHGSRWTGMY VQLRADWTIA SNLTGSVEAV HFQVGDSIRN AGGSNSDYVG       480
     VEMKYGW                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page