(data stored in ACNUC7421 zone)

EMBL: CP000272.PE189

CP000272.PE189       Location/Qualifiers
FT   CDS             complement(214001..214783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0193"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36117"
FT                   /db_xref="GOA:Q13IH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH2"
FT                   /protein_id="ABE36117.1"
FT                   /translation="MIDVDALTVRFRTRTGYFDAVREASFHVGAGEVFGLVGESGSGKS
FT                   TILRALTGLAPLAGGHMKIGSHGPGEKIDRSFRRDVQMVFQDPYGSLHPRFTVDRALRE
FT                   PLTINGIDRQDERIVDALREVGLGPAYRFRYPHQLSGGQRQRVAIARALIVEPRVLLLD
FT                   EPTSALDVSVQAEILNLLRRLHRERNLTMILVSHNLAVVGFLCSRVAVMRNGEIVEQRD
FT                   IASIRARQVEHEYTRNLLLATTGYRRNAVQATGTDAAL"
     MIDVDALTVR FRTRTGYFDA VREASFHVGA GEVFGLVGES GSGKSTILRA LTGLAPLAGG        60
     HMKIGSHGPG EKIDRSFRRD VQMVFQDPYG SLHPRFTVDR ALREPLTING IDRQDERIVD       120
     ALREVGLGPA YRFRYPHQLS GGQRQRVAIA RALIVEPRVL LLDEPTSALD VSVQAEILNL       180
     LRRLHRERNL TMILVSHNLA VVGFLCSRVA VMRNGEIVEQ RDIASIRARQ VEHEYTRNLL       240
     LATTGYRRNA VQATGTDAAL                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page