(data stored in ACNUC7421 zone)

EMBL: CP000272.PE19

CP000272.PE19        Location/Qualifiers
FT   CDS             26316..27263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0020"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35947"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ2"
FT                   /protein_id="ABE35947.1"
FT                   /translation="MAFGASSSRAFAQELALYTGPLTGEHSHSYSWSIDYTEGFGRYFA
FT                   SSITWLNEGHIPDHHRDGPVVQLWGRLPLMERRFVVALGVGPYRYFDTEAATQGAGYSN
FT                   THGWGVVYSARASWYSSQRWTANLQLNHVQVTNGASTTAVMFGVGYQLDAPGTPGARDF
FT                   ALPRASKVTNNEITLMAGATILNSLESQTSTAQAIEYRRGLTNYLDATLGYLHEGNGLS
FT                   ARRDGATAQLWLTRAFLNDHLALGVGVGAYAAIHHGDSSDNRDTGDGILSGLVSISASY
FT                   RITQHWSARLTWNRVMTRYSRDTDVILGGVGYRF"
     MAFGASSSRA FAQELALYTG PLTGEHSHSY SWSIDYTEGF GRYFASSITW LNEGHIPDHH        60
     RDGPVVQLWG RLPLMERRFV VALGVGPYRY FDTEAATQGA GYSNTHGWGV VYSARASWYS       120
     SQRWTANLQL NHVQVTNGAS TTAVMFGVGY QLDAPGTPGA RDFALPRASK VTNNEITLMA       180
     GATILNSLES QTSTAQAIEY RRGLTNYLDA TLGYLHEGNG LSARRDGATA QLWLTRAFLN       240
     DHLALGVGVG AYAAIHHGDS SDNRDTGDGI LSGLVSISAS YRITQHWSAR LTWNRVMTRY       300
     SRDTDVILGG VGYRF                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page