(data stored in ACNUC7421 zone)

EMBL: CP000272.PE191

CP000272.PE191       Location/Qualifiers
FT   CDS             complement(215660..216574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0195"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36119"
FT                   /db_xref="GOA:Q13IH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH0"
FT                   /protein_id="ABE36119.1"
FT                   /translation="MNAVRRRWQDWLLSDTPASRKQAALGLAYRRWRRFAGNPLSVFGL
FT                   AILALLIIIAAIGPLIAPHDPLQQVLSDRLLPPGASSHWLGTDQLGRDILSRLIYGSRL
FT                   TLSIAILVVVIVVPVGLLIGTTAGFFGDWVDNVLMRLTDVALAFPKIVLALAFAAALGP
FT                   GVVNAVIAISITAWPAYARLARAETLRLVQADFIHVARLQGASRTRILLRYIVPLCSSS
FT                   VIVRATLDMAGIILTVAGLGFLGLGAQPPSPEWGFMVASGRNVLLDSWWVATIPGFAIL
FT                   LVSLAFNLLGDGLRDVFDPRHGN"
     MNAVRRRWQD WLLSDTPASR KQAALGLAYR RWRRFAGNPL SVFGLAILAL LIIIAAIGPL        60
     IAPHDPLQQV LSDRLLPPGA SSHWLGTDQL GRDILSRLIY GSRLTLSIAI LVVVIVVPVG       120
     LLIGTTAGFF GDWVDNVLMR LTDVALAFPK IVLALAFAAA LGPGVVNAVI AISITAWPAY       180
     ARLARAETLR LVQADFIHVA RLQGASRTRI LLRYIVPLCS SSVIVRATLD MAGIILTVAG       240
     LGFLGLGAQP PSPEWGFMVA SGRNVLLDSW WVATIPGFAI LLVSLAFNLL GDGLRDVFDP       300
     RHGN                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page